DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and phx1

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_593776.1 Gene:phx1 / 2542405 PomBaseID:SPAC32A11.03c Length:942 Species:Schizosaccharomyces pombe


Alignment Length:85 Identity:30/85 - (35%)
Similarity:41/85 - (48%) Gaps:14/85 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AHYLETVE-GGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASV 184
            ||...|.| ||:||:.         |||.:|:    |.:||..|...|..|:||.....|:|...
pombe   151 AHESGTPESGGSTSAP---------KSKKQRL----TADQLAYLLREFSKDTNPPPAIREKIGRE 202

  Fly   185 TGLSKRVTQVWFQNSRARQK 204
            ..:.:|...:||||.||:.|
pombe   203 LNIPERSVTIWFQNRRAKSK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765 1/1 (100%)
Homeobox 152..204 CDD:278475 17/51 (33%)
phx1NP_593776.1 COG5576 116..272 CDD:227863 30/85 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.