DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and Gsc2

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_083745.2	Gene:	Gsc2 / 195333	MGIID:	892006	Length:	201	Species:	Mus musculus

Alignment Length:	78	Identity:	29/78 - (37%)
Similarity:	44/78 - (56%)	Gaps:	1/78 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   137 GCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRA 201
            |..|.|..: :|:|.||.|:|||||.|:|.|..:..||....||:|....|.:...:|||:|.||
Mouse   113 GTSGPGPQR-RTRRHRTIFSEEQLQALEALFVQNQYPDVGTRERLAVRIRLREERVEVWFKNRRA 176

  Fly   202 RQKKHIHAGKNKI 214
            :.:....|..:::
Mouse   177 KWRHQKRASSSRL 189

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759
		LIM2_AWH	69..123	CDD:188765
		Homeobox	152..204	CDD:278475	23/51 (45%)
Gsc2	NP_083745.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..53
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	96..123		3/10 (30%)
		Homeobox	126..180	CDD:333795	23/53 (43%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	179..201		1/11 (9%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940