DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and alp-1

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001023371.1 Gene:alp-1 / 177701 WormBaseID:WBGene00001132 Length:1424 Species:Caenorhabditis elegans


Alignment Length:123 Identity:39/123 - (31%)
Similarity:50/123 - (40%) Gaps:19/123 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CAACGEPISDRFFLEVGGC------SWHAHCLRCCMCMCPLDRQQSCFIRERQV-YCKADYSKNF 65
            |..|.:||       :..|      .||..|..|..|..|..  .|.|..|:.: ||:.|::..|
 Worm  1312 CNKCSKPI-------ISDCLNALQKKWHPTCFTCAHCQKPFG--NSAFYLEQGLPYCEQDWNALF 1367

  Fly    66 GAKCSKCCRGISASD-WVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAH 122
            ..||..|...|.|.| || .|....||..||.|.:|...|. ||.|...:.:..|:.|
 Worm  1368 TTKCVSCRYPIEAGDRWV-EALGNAFHSNCFTCARCNHNLE-GESFFAKNGQPFCRLH 1423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 16/59 (27%)
LIM2_AWH 69..123 CDD:188765 20/55 (36%)
Homeobox 152..204 CDD:278475
alp-1NP_001023371.1 PDZ_signaling 5..80 CDD:238492
DUF4749 137..>197 CDD:292558
ZM 137..162 CDD:128974
LIM_ALP_like 220..271 CDD:188746
LIM1_Enigma_like_1 1251..1304 CDD:188839
LIM 1312..1363 CDD:295319 16/59 (27%)
LIM3_Enigma_like_1 1371..1424 CDD:188845 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.