DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and Zfhx3

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_031522.2	Gene:	Zfhx3 / 11906	MGIID:	99948	Length:	3723	Species:	Mus musculus

Alignment Length:	81	Identity:	36/81 - (44%)
Similarity:	49/81 - (60%)	Gaps:	2/81 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   125 ETVEGGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSK 189
            |........:|.|..|:  ...:.||:|||.|.|||::|...:.:||||..:.|:.||...||.|
Mouse  2629 EKASASPGENDSGTGGE--EPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKK 2691

  Fly   190 RVTQVWFQNSRARQKK 205
            ||.||||||:|||::|
Mouse  2692 RVVQVWFQNTRARERK 2707

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759
		LIM2_AWH	69..123	CDD:188765
		Homeobox	152..204	CDD:278475	29/51 (57%)
Zfhx3	NP_031522.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..79
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	95..129
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	417..557
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	590..621
		C2H2 Zn finger	674..694	CDD:275368
		C2H2 Zn finger	729..746	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1125..1228
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1320..1361
		C2H2 Zn finger	1375..1395	CDD:275368
		C2H2 Zn finger	1413..1433	CDD:275371
		C2H2 Zn finger	1441..1462	CDD:275371
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1500..1539
		C2H2 Zn finger	1557..1581	CDD:275368
		C2H2 Zn finger	1608..1626	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1639..1678
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1706..1738
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1866..1943
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2037..2089
		HOX	2152..2208	CDD:197696
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2211..2249
		Homeobox	2252..2306	CDD:365835
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2383..2405
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2429..2529
		COG5576	2603..2747	CDD:227863	36/81 (44%)
		Nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:Q15911	2624..2626
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2628..2656		7/28 (25%)
		Homeobox	2654..2707	CDD:365835	29/52 (56%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2780..2805
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2850..2877
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2920..2955
		Homeobox	2958..3011	CDD:365835
		Herpes_BLLF1	<3112..>3191	CDD:282904
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3145..3274
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3412..3473
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3585..3723
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000