DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and LDB3

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_001165081.1	Gene:	LDB3 / 11155	HGNCID:	15710	Length:	732	Species:	Homo sapiens

Alignment Length:	142	Identity:	39/142 - (27%)
Similarity:	54/142 - (38%)	Gaps:	16/142 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRER-QVYCKADYSKNFGAKCSK 71
            |..|...|...|.:.:|. |||.....|..|...|  ...||:.|: .|||:..|.:.|...|:|
Human   556 CGHCNNVIRGPFLVAMGR-SWHPEEFTCAYCKTSL--ADVCFVEEQNNVYCERCYEQFFAPLCAK 617

  Fly    72 CCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETVEGGTTSSDE 136
            |...|...  |..|....:|..||.|..|.:... ...|.:.|....|:..|:...    ::...
Human   618 CNTKIMGE--VMHALRQTWHTTCFVCAACKKPFG-NSLFHMEDGEPYCEKDYINLF----STKCH 675

  Fly   137 GCD-----GDGY 143
            |||     ||.:
Human   676 GCDFPVEAGDKF 687

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759	17/53 (32%)
		LIM2_AWH	69..123	CDD:188765	14/53 (26%)
		Homeobox	152..204	CDD:278475
LDB3	NP_001165081.1	PDZ_signaling	5..81	CDD:238492
		DUF4045	<77..180	CDD:330572
		ZM	189..214	CDD:128974
		DUF4749	263..353	CDD:318205
		Atrophin-1	<387..554	CDD:331285
		LIM1_ZASP_Cypher	556..607	CDD:188838	17/53 (32%)
		LIM2_Enigma_like	615..666	CDD:188748	14/53 (26%)
		LIM3_Enigma_like	674..727	CDD:188749	5/14 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940