DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and zfhx3

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_002937624.2 Gene:zfhx3 / 100495855 XenbaseID:XB-GENE-853731 Length:3619 Species:Xenopus tropicalis


Alignment Length:81 Identity:36/81 - (44%)
Similarity:49/81 - (60%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ETVEGGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSK 189
            |........:|.|..|:  ...:.||:|||.|.|||::|...:.:||||..:.|:.||...||.|
 Frog  2599 EKANASPGENDSGTGGE--EPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKK 2661

  Fly   190 RVTQVWFQNSRARQKK 205
            ||.||||||:|||::|
 Frog  2662 RVVQVWFQNTRARERK 2677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 29/51 (57%)
zfhx3XP_002937624.2 C2H2 Zn finger 663..683 CDD:275368
C2H2 Zn finger 718..735 CDD:275368
C2H2 Zn finger 1365..1385 CDD:275368
C2H2 Zn finger 1403..1423 CDD:275371
C2H2 Zn finger 1431..1452 CDD:275371
C2H2 Zn finger 1547..1569 CDD:275368
C2H2 Zn finger 1598..1616 CDD:275368
HOX 2122..2178 CDD:197696
Homeobox 2222..2276 CDD:365835
COG5576 2590..2717 CDD:227863 36/81 (44%)
Homeobox 2624..2677 CDD:365835 29/52 (56%)
Homeobox 2926..2979 CDD:365835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.