DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and zfhx3b

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001352117.1 Gene:zfhx3b / 100333211 ZFINID:ZDB-GENE-030131-7577 Length:3838 Species:Danio rerio


Alignment Length:170 Identity:52/170 - (30%)
Similarity:74/170 - (43%) Gaps:23/170 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EGGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVT 192
            :.||:..:......|....:.||:|||.|.|||::|...:.:||||..:.|:.||...||.|||.
Zfish  2751 KAGTSPGESDSMNSGEEPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVV 2815

  Fly   193 QVWFQNSRARQKKHIHAGKNKIREPEGSSFARHINLQLTYSFQNNAQNPMHL------------- 244
            ||||||:|||::|.........:......|.|.:       |:.......|:             
Zfish  2816 QVWFQNTRARERKGQFRAVGPAQAHRRCPFCRAL-------FKAKTALEAHIRSRHWHEAKRAGY 2873

  Fly   245 NGSKAGLYPTHES---SMDELSQDSSVHCMPSEVXLEQSS 281
            |.:.:||.|..|:   .||.|...|..|...|....:.||
Zfish  2874 NLALSGLLPEQEAMQLKMDPLDISSYAHLAQSNNDAQCSS 2913

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 29/51 (57%)
zfhx3bNP_001352117.1 C2H2 Zn finger 734..755 CDD:275368
C2H2 Zn finger 765..802 CDD:275368
C2H2 Zn finger 820..837 CDD:275368
PHA00732 1339..>1391 CDD:177300
C2H2 Zn finger 1489..1509 CDD:275368
C2H2 Zn finger 1527..1552 CDD:275368
C2H2 Zn finger 1555..1574 CDD:275368
SFP1 <1610..1739 CDD:227516
C2H2 Zn finger 1672..1696 CDD:275368
C2H2 Zn finger 1723..1741 CDD:275368
HOX 2283..2339 CDD:197696
Homeobox 2383..2436 CDD:306543
Abdominal-A 2723..2868 CDD:332641 39/123 (32%)
Homeobox 2775..2827 CDD:306543 29/51 (57%)
Abdominal-A 3031..>3137 CDD:332641
Homeobox 3073..3125 CDD:306543
Herpes_BLLF1 <3228..>3401 CDD:330317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.