DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRAS and RAS1

DIOPT Version :9

Sequence 1:NP_001356715.1 Gene:KRAS / 3845 HGNCID:6407 Length:189 Species:Homo sapiens
Sequence 2:NP_014744.1 Gene:RAS1 / 854268 SGDID:S000005627 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:103/163 - (63%)
Similarity:131/163 - (80%) Gaps:1/163 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67
            |||:||||.|||||||||||.||::||||||||||||||||||||.:..:|||||||||||||||
Yeast    10 EYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSILDILDTAGQEEYSAM 74

Human    68 RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPS-RTVDTKQAQ 131
            |:||||||||||.|:::.:..||:::..|.:||:|||||:.:|:|:||||.||.: |.|..:...
Yeast    75 REQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIPVVVVGNKLDLENERQVSYEDGL 139

Human   132 DLARSYGIPFIETSAKTRQRVEDAFYTLVREIR 164
            .||:....||:|||||....|::|||:|:|.:|
Yeast   140 RLAKQLNAPFLETSAKQAINVDEAFYSLIRLVR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRASNP_001356715.1 H_N_K_Ras_like 3..164 CDD:133338 102/161 (63%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185
RAS1NP_014744.1 small_GTPase 9..172 CDD:197466 102/161 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.