DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRAS and Kras

DIOPT Version :9

Sequence 1:NP_001356715.1 Gene:KRAS / 3845 HGNCID:6407 Length:189 Species:Homo sapiens
Sequence 2:XP_017447932.1 Gene:Kras / 24525 RGDID:2981 Length:189 Species:Rattus norvegicus


Alignment Length:189 Identity:187/189 - (98%)
Similarity:189/189 - (100%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

Human    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQA 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQA 130

Human   131 QDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 189
            |:||||||||||||||||||||||||||||||||||||||||||||||||||||||:||
  Rat   131 QELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCVIM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRASNP_001356715.1 H_N_K_Ras_like 3..164 CDD:133338 159/160 (99%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 18/18 (100%)
KrasXP_017447932.1 H_N_K_Ras_like 3..164 CDD:133338 159/160 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83678898
Domainoid 1 1.000 320 1.000 Domainoid score I14387
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37990
Inparanoid 1 1.050 378 1.000 Inparanoid score I13526
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - oto143310
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X934
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1515.400

Return to query results.
Submit another query.