DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRAS and krasl

DIOPT Version :9

Sequence 1:NP_001356715.1 Gene:KRAS / 3845 HGNCID:6407 Length:189 Species:Homo sapiens
Sequence 2:XP_004920180.1 Gene:krasl / 100485959 XenbaseID:XB-GENE-22063560 Length:226 Species:Xenopus tropicalis


Alignment Length:189 Identity:185/189 - (97%)
Similarity:188/189 - (99%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

Human    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQA 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQA 130

Human   131 QDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 189
            ||||||||||||||||||||||||||||||||||||||||:|||||||||||:|||.:|
 Frog   131 QDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKMSKEEKTPGCVKVKKCRVM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRASNP_001356715.1 H_N_K_Ras_like 3..164 CDD:133338 160/160 (100%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 16/18 (89%)
kraslXP_004920180.1 H_N_K_Ras_like 3..164 CDD:133338 160/160 (100%)
RAS 16..166 CDD:214541 149/149 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 322 1.000 Domainoid score I8418
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37990
Inparanoid 1 1.050 376 1.000 Inparanoid score I9445
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - oto158944
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.