DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32262 and Mpv17l

DIOPT Version :10

Sequence 1:NP_647831.1 Gene:CG32262 / 38445 FlyBaseID:FBgn0052262 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_291042.2 Gene:Mpv17l / 93734 MGIID:2135951 Length:194 Species:Mus musculus


Alignment Length:176 Identity:44/176 - (25%)
Similarity:70/176 - (39%) Gaps:20/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AWSNMF----GKYLLVTNVVGSGLLMVVGDVIAQEYEYRRGLRHQDRFDTDRMYRMFVAGALQGP 128
            :|...|    .:|...|||:....|...||.:.|..   || ...|...|.|:..:.|.      
Mouse     3 SWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRL---RG-GPADWRQTRRVATLAVT------ 57

  Fly   129 LH-HYVYNW---MDRVMPARTLKNIFKKILIDQLVMSPACIVIFFYSLCYLERQTLDATNQELIS 189
            .| ::.|.|   ::|.:|.|..:.:..|:|.||.|..|..:..|:..:..|  |..|....:|..
Mouse    58 FHGNFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVL--QGKDDIFLDLKQ 120

  Fly   190 KFPYVYMLDWMTWPAAQYLNFRYLDTKYRVTFVNVCTAVYNVLMSY 235
            ||...|....|.||..|..||..:...:|..:..:|..::...:.:
Mouse   121 KFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32262NP_647831.1 Mpv17_PMP22 175..234 CDD:461182 15/58 (26%)
Mpv17lNP_291042.2 Targeting to peroxisomes 16..55 12/42 (29%)
Mpv17_PMP22 106..165 CDD:461182 15/60 (25%)

Return to query results.
Submit another query.