DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32264 and AFR1

DIOPT Version :9

Sequence 1:NP_728897.1 Gene:CG32264 / 38438 FlyBaseID:FBgn0052264 Length:1008 Species:Drosophila melanogaster
Sequence 2:NP_010370.1 Gene:AFR1 / 851658 SGDID:S000002492 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:47/238 - (19%)
Similarity:84/238 - (35%) Gaps:56/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   809 NKEN------ARPFVIRESSSD-SDDSDGHIVYRDEDNDNTR---LAKLARKESLSL-------- 855
            :|||      .|...||:...: |.:.||.:.:||.:..|..   :.|...:|...|        
Yeast   396 SKENDKYDLRRRQLEIRQKLHETSHNDDGKVSFRDTEKHNVNEGLIDKTIIEEFSKLGEYIIDTR 460

  Fly   856 -----KLQLRPDKQDLINRNILHQVNDNELKESKEA-------IGARLIRRL-------SMRPTA 901
                 :...||...|..:....:.:: .:|::|...       :|..::.||       ......
Yeast   461 NQPPPRSSKRPSLDDNESARYFYNIS-TDLRQSLSGPISLPMHVGNDMVNRLRNDWEYIRFEDRR 524

  Fly   902 EELVERNILKTQSPAEE-KKQKEEKKSYLLRKLSFRPTVEELKEKKIIRFNDYIEVTQAHDYDRR 965
            ..|.:.:..|.::|.:. ||.....|...|.........|....:.|:..:..:.:.:.|     
Yeast   525 NSLPDSSFDKVETPPKPIKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVH----- 584

  Fly   966 ADKPWTRLTPKDKAA---IRKELNEFKSSEMAVHEGSRHLTRF 1005
                     |...:|   |:.|||.:|.:||.|||.|:..|.:
Yeast   585 ---------PSMNSAMNEIKLELNSYKKNEMVVHENSKCFTHY 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32264NP_728897.1 RPEL 325..347 CDD:280851
RPEL 851..876 CDD:128947 5/37 (14%)
RPEL 889..914 CDD:128947 4/31 (13%)
RPEL 927..952 CDD:128947 3/24 (13%)
AFR1NP_010370.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12751
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.