DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2n

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_006514407.1 Gene:Ube2n / 93765 MGIID:1934835 Length:171 Species:Mus musculus


Alignment Length:147 Identity:63/147 - (42%)
Similarity:86/147 - (58%) Gaps:4/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 PLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYP 271
            |.|....:|.::|    ...|.|||....|..::...|.||.::.:|||.|::|:..|..||...
Mouse    25 PATAQETQRLLAE----PVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAA 85

  Fly   272 PYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKG 336
            |.:.|:||.||.|:...||||||||..||||||.:..||:||.:||:.|||.||:...||:.:|.
Mouse    86 PKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKT 150

  Fly   337 NRALHDKNAREWTKKYA 353
            |.|...:.||.||:.||
Mouse   151 NEAQAIETARAWTRLYA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 63/147 (43%)
UQ_con 212..349 CDD:278603 57/136 (42%)
Ube2nXP_006514407.1 UBCc 29..170 CDD:381827 61/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.