DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and UBE2Q2

DIOPT Version :10

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_775740.1 Gene:UBE2Q2 / 92912 HGNCID:19248 Length:375 Species:Homo sapiens


Alignment Length:255 Identity:50/255 - (19%)
Similarity:91/255 - (35%) Gaps:77/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LTRGLPT----VTENVPMDETFDTESLQSNSLVLRLFRIESGIPTQG----------DPLTI--- 210
            |.:.|||    .||.|..:|..:.|.:..:...|..:.::...|..|          :.|.|   
Human   121 LDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEK 185

  Fly   211 ---------------------TRLRREISEFSTDQ---TEGCKAEMVGDNLFHWVATIP--GPSE 249
                                 .||.:|:.:....|   |.....|::.|:|:.|...:.  .|..
Human   186 IRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDS 250

  Fly   250 TVY---------EGGRFRVEIV-----FPRNYPFYPPYLAFLTKTYHCNIAL-SGRICLDILGSK 299
            .::         ||    :|.:     |..|:||.||::..:.........| .|.:|:::|..:
Human   251 PLHSDLQILKEKEG----IEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQ 311

  Fly   300 -WSPALSVSKVLISIMSLL----------ADPNPHDPMEVSVADVFKGNRALHDKNAREW 348
             ||.|.|:..|::.|.:.|          |:.|.::......:  :.....:|:||.  |
Human   312 GWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQS--YNSIVQIHEKNG--W 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 UBCc_UEV 212..352 CDD:483950 36/168 (21%)
UBE2Q2NP_775740.1 RWD 9..89 CDD:413438
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..174 11/50 (22%)
UBCc_UBE2Q 207..362 CDD:467422 32/160 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.