DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and UBC28

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001154446.1 Gene:UBC28 / 842728 AraportID:AT1G64230 Length:190 Species:Arabidopsis thaliana


Alignment Length:121 Identity:67/121 - (55%)
Similarity:89/121 - (73%) Gaps:0/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 VGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILG 297
            |.:::|||.|||.|||::.|.||.|.|.|.||.:|||.||.:||.||.:|.|:..:|.||||||.
plant    68 VAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILK 132

  Fly   298 SKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALHDKNAREWTKKYA 353
            .:|||||::||||:||.|||.||||.||:...:|.::|.:||.::..||.||:|||
plant   133 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 67/121 (55%)
UQ_con 212..349 CDD:278603 62/115 (54%)
UBC28NP_001154446.1 COG5078 1..189 CDD:227410 67/121 (55%)
UBCc 1..188 CDD:294101 65/119 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.