DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and UBC30

DIOPT Version :10

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_851198.1 Gene:UBC30 / 835714 AraportID:AT5G56150 Length:148 Species:Arabidopsis thaliana


Alignment Length:142 Identity:71/142 - (50%)
Similarity:96/142 - (67%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAF 276
            |:.:|:.:...|....|.|...||::|.|.|||.||:::.:.||.|.|.|.||.:|||.||.:||
plant     5 RINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAF 69

  Fly   277 LTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALH 341
            .||.||.||..:|.||||||..:|||||:|||||:||.|||.||||.||:...:|.::|.:|..:
plant    70 RTKVYHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTDRVKY 134

  Fly   342 DKNAREWTKKYA 353
            :..|:.||:|||
plant   135 ESTAQSWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 UBCc_UEV 212..352 CDD:483950 68/139 (49%)
UBC30NP_851198.1 UBCc_UBE2D 3..145 CDD:467412 68/139 (49%)

Return to query results.
Submit another query.