DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and UBC9

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_567791.1 Gene:UBC9 / 828909 AraportID:AT4G27960 Length:178 Species:Arabidopsis thaliana


Alignment Length:193 Identity:81/193 - (41%)
Similarity:111/193 - (57%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 MHLTRGLPTVTENVPMDETFDTESLQSNSLVLRLFRIESGIPTQGDPLTITRLRREISEFSTDQT 225
            :|||.||           .||......|        ::.||.    .:...|:.:|:.:...|..
plant     7 IHLTIGL-----------VFDCRVFNWN--------LDRGIL----EMASKRILKELKDLQKDPP 48

  Fly   226 EGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFLTKTYHCNIALSGR 290
            ..|.|..|.:::|||.|||.|||::.|.||.|.|.|.||.:|||.||.:||.||.:|.||..:|.
plant    49 TSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGS 113

  Fly   291 ICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALHDKNAREWTKKYA 353
            ||||||..:|||||::||||:||.|||.||||.||:...:|.::|.::..::..||.||:|||
plant   114 ICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 71/147 (48%)
UQ_con 212..349 CDD:278603 66/136 (49%)
UBC9NP_567791.1 COG5078 31..177 CDD:227410 71/146 (49%)
UBCc 31..176 CDD:294101 69/144 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.