DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and ube2r2

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001072702.1 Gene:ube2r2 / 780159 XenbaseID:XB-GENE-994678 Length:238 Species:Xenopus tropicalis


Alignment Length:156 Identity:52/156 - (33%)
Similarity:82/156 - (52%) Gaps:19/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 LRREISEFSTDQTEGCKAEMVGD-NLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAF 276
            |..|:.....:..||.:..:|.: :|::|...|.||..|:||||.|:..|.||.:||:.||...|
 Frog    13 LMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRF 77

  Fly   277 LTKTYHCNIALSGRICLDIL-------------GSKWSPALSVSKVLISIMSLLADPNPHDPMEV 328
            |||.:|.||..:|.:|:.||             ..:|:|..:|..:|:|::|||.:||...|..|
 Frog    78 LTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANV 142

  Fly   329 SVADVFKGNRALHDKNAREWTKKYAK 354
            ..:.:|   |...|...::  |:||:
 Frog   143 DASVMF---RKWRDSKGKD--KEYAE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 51/154 (33%)
UQ_con 212..349 CDD:278603 49/149 (33%)
ube2r2NP_001072702.1 UBCc 11..169 CDD:238117 52/156 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.