DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2d2a

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_064296.1 Gene:Ube2d2a / 56550 MGIID:1930715 Length:147 Species:Mus musculus


Alignment Length:146 Identity:74/146 - (50%)
Similarity:106/146 - (72%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPP 272
            :.:.|:.:|:::.:.|....|.|..|||::|||.|||.||:::.|:||.|.:.|.||.:|||.||
Mouse     1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPP 65

  Fly   273 YLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGN 337
            .:||.|:.||.||..:|.||||||.|:|||||::||||:||.|||.||||.||:...:|.::|.:
Mouse    66 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130

  Fly   338 RALHDKNAREWTKKYA 353
            |..:::.|||||:|||
Mouse   131 REKYNRIAREWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 74/146 (51%)
UQ_con 212..349 CDD:278603 69/136 (51%)
Ube2d2aNP_064296.1 UBCc 1..146 CDD:412187 72/144 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.