DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and ube2e1

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001096586.1 Gene:ube2e1 / 563542 ZFINID:ZDB-GENE-071004-16 Length:195 Species:Danio rerio


Alignment Length:142 Identity:71/142 - (50%)
Similarity:96/142 - (67%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAF 276
            |:::|:::...|....|.|...|||::.|.:||.||..:|||||.|.::|.|..:|||.||.:.|
Zfish    53 RIQKELADIMLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIAFTPDYPFKPPKVTF 117

  Fly   277 LTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALH 341
            .|:.|||||...|.||||||...|||||::||||:||.|||.|.||.||:..|:|..:..||..|
Zfish   118 RTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYTTNRPEH 182

  Fly   342 DKNAREWTKKYA 353
            |:.|::|||:||
Zfish   183 DRIAKQWTKRYA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 71/142 (50%)
UQ_con 212..349 CDD:278603 66/136 (49%)
ube2e1NP_001096586.1 COG5078 48..194 CDD:227410 69/140 (49%)
UQ_con 53..190 CDD:278603 66/136 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.