DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and ube2ka

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001013500.1 Gene:ube2ka / 541355 ZFINID:ZDB-GENE-050320-48 Length:200 Species:Danio rerio


Alignment Length:146 Identity:56/146 - (38%)
Similarity:90/146 - (61%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LTITRLRREISE-FSTDQT--EGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPF 269
            :.:.|::||..| ..:::|  ...|.::|.:|.......|.||.:|.|||||:::||..|..|||
Zfish     4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPF 68

  Fly   270 YPPYLAFLTKTYHCNI-ALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADV 333
            .||.:.|:||.:|.|| :::|.||||||..:|:.|:::..||:|:.:|||...|.||.:..||:.
Zfish    69 NPPKVRFITKIWHPNISSVTGAICLDILKGQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQ 133

  Fly   334 FKGNRALHDKNAREWT 349
            :|.|..:..:.||.|:
Zfish   134 YKQNPEMFKQTARLWS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 56/146 (38%)
UQ_con 212..349 CDD:278603 55/140 (39%)
ube2kaNP_001013500.1 COG5078 1..148 CDD:227410 55/143 (38%)
UBCc 6..148 CDD:238117 55/141 (39%)
UBA_like_SF 163..200 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.