DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and vih

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:56/155 - (36%)
Similarity:80/155 - (51%) Gaps:9/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 ESGIPTQGDPLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIV 262
            :..:|.:.:.....||.:|:.........|..|...|:|:|.||.||.||..|||.|..:|:.:.
  Fly    22 DDSMPVKDNHAVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLD 86

  Fly   263 FPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPME 327
            ||.:||:..|.:.|||..:|.|:.|.|.||||||..|||....|..:|:||.|||.:||...|:.
  Fly    87 FPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLN 151

  Fly   328 VSVADVFKGNRALHDKNAREWTKKY 352
            ...|.::         |.::..|||
  Fly   152 AQAAMMW---------NDQKEYKKY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 55/146 (38%)
UQ_con 212..349 CDD:278603 52/136 (38%)
vihNP_648582.1 COG5078 31..166 CDD:227410 52/143 (36%)
UQ_con 36..172 CDD:278603 55/141 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.