DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and CG5823

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:135 Identity:36/135 - (26%)
Similarity:61/135 - (45%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SGIPTQG---DPLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVE 260
            |...|.|   .|..::|::::......|......||.:.:|:..|...:.||.::.|.||.:...
  Fly     2 SSSSTSGGRKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGYYHGT 66

  Fly   261 IVFPRNYPFYPPYLAFLT-----KTYHCNIALSGRICL---DILGSKWSPALSVSKVLISIMSLL 317
            ::|||.:||.||.:..||     ||       :.|:||   |.....|:|...|..:|..::|.:
  Fly    67 LLFPREFPFKPPSIYMLTPNGRFKT-------NTRLCLSISDFHPDTWNPTWCVGTILTGLLSFM 124

  Fly   318 ADPNP 322
            .:..|
  Fly   125 LESTP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 33/124 (27%)
UQ_con 212..349 CDD:278603 32/119 (27%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.