DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and ube2na

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_998651.1 Gene:ube2na / 406807 ZFINID:ZDB-GENE-040426-2873 Length:154 Species:Danio rerio


Alignment Length:155 Identity:63/155 - (40%)
Similarity:88/155 - (56%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SGIPTQGDPLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVF 263
            :|:|        .|:.:|......:...|.|||....|..::...|.||.::.:|||.|::|:..
Zfish     2 AGLP--------RRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFL 58

  Fly   264 PRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEV 328
            |..||...|.:.|:||.||.|:...||||||||..||||||.:..||:||.:||:.|||.||:..
Zfish    59 PEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLAN 123

  Fly   329 SVADVFKGNRALHDKNAREWTKKYA 353
            .||:.:|.|.|...:.||.||:.||
Zfish   124 DVAEQWKTNEAQAIETARTWTRLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 61/147 (41%)
UQ_con 212..349 CDD:278603 57/136 (42%)
ube2naNP_998651.1 UBCc 4..151 CDD:412187 62/153 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.