DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Uev1A

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:132 Identity:31/132 - (23%)
Similarity:53/132 - (40%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TQGDPLTITRLRREISEFSTDQTEGCKAEMVGD-------------NLFHWVATIPGPSETVYEG 254
            |....:.:.|..|.:.|....|      :.|||             .|.:|:..|.||..|.:|.
  Fly     4 TSSTGVVVPRNFRLLEELDQGQ------KGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFEN 62

  Fly   255 GRFRVEIVFPRNYPFYPPYLAFLTK-TYHC---NIALSGRICLDILGSKWSPALSVSKVLISIMS 315
            ..:.::|.....||..||.|.|:|| ..:|   |..:.....:.:| ::||...::..:|..|..
  Fly    63 RMYSLKIECGERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQML-ARWSREYNIKTMLQEIRR 126

  Fly   316 LL 317
            ::
  Fly   127 IM 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 30/128 (23%)
UQ_con 212..349 CDD:278603 30/123 (24%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 29/120 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.