DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2d1

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_017457176.1 Gene:Ube2d1 / 361831 RGDID:1307886 Length:194 Species:Rattus norvegicus


Alignment Length:158 Identity:80/158 - (50%)
Similarity:106/158 - (67%) Gaps:1/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 RIESGIPTQGDPLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVE 260
            |...|.|. |...|:.....|:|:...|....|.|..|||:||||.|||.||.::.|:||.|.:.
  Rat    37 RCSVGFPF-GSFQTLLLFVMELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLT 100

  Fly   261 IVFPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDP 325
            :.||.:|||.||.:||.||.||.||..:|.||||||.|:|||||:|||||:||.|||.||||.||
  Rat   101 VHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDP 165

  Fly   326 MEVSVADVFKGNRALHDKNAREWTKKYA 353
            :...:|.::|.::..::::|||||:|||
  Rat   166 LVPDIAQIYKSDKEKYNRHAREWTQKYA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 76/147 (52%)
UQ_con 212..349 CDD:278603 70/136 (51%)
Ube2d1XP_017457176.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.