DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2t

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001101814.2 Gene:Ube2t / 360847 RGDID:1310816 Length:204 Species:Rattus norvegicus


Alignment Length:148 Identity:59/148 - (39%)
Similarity:86/148 - (58%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 TRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLA 275
            :||::|:...:.:...|.......|.:.:..|.|.|.:.|.||.|.|.:|::.|..|||.||.:.
  Rat     5 SRLKKELHMLAIEPPPGVTCWQEKDKMDNLRAQILGGANTPYEKGIFTLEVIVPERYPFEPPQIR 69

  Fly   276 FLTKTYHCNIALSGRICLDIL----GSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKG 336
            |||..||.||..|||||||||    ...|.|:|:::.||.||..|:|:|||.||:...::..||.
  Rat    70 FLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKY 134

  Fly   337 NRALHDKNAREWTKKYAK 354
            |:....|.||:||:.:|:
  Rat   135 NKIAFVKKARQWTETHAR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 58/146 (40%)
UQ_con 212..349 CDD:278603 56/140 (40%)
Ube2tNP_001101814.2 UBCc 5..147 CDD:238117 56/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.