DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and CG5440

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:164 Identity:79/164 - (48%)
Similarity:104/164 - (63%) Gaps:3/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LFRIESGIPTQG---DPLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGG 255
            ||..|.|.|:..   ....:.|:::|:.|.:.|..:.|.|....|||:.|.:||.||:::|||.|
  Fly     4 LFSAEDGTPSCSWTCSNSAVKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENG 68

  Fly   256 RFRVEIVFPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADP 320
            .|:::|.||..|||.||.:.|.|..|||||...|.||||||..||||||::||:|:||.|||.|.
  Fly    69 IFKLDIFFPVEYPFAPPVVIFRTPIYHCNIHRLGFICLDILKEKWSPALTISKILLSICSLLTDC 133

  Fly   321 NPHDPMEVSVADVFKGNRALHDKNAREWTKKYAK 354
            ||.||:...:...:..|||.|||.||.|||:|||
  Fly   134 NPKDPLMAKIGTEYLKNRAEHDKKARLWTKRYAK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 72/146 (49%)
UQ_con 212..349 CDD:278603 68/136 (50%)
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 74/149 (50%)
UQ_con 25..162 CDD:278603 68/136 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124127at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.