DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and ube2d1b

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_955958.1 Gene:ube2d1b / 324015 ZFINID:ZDB-GENE-030131-2735 Length:147 Species:Danio rerio


Alignment Length:146 Identity:77/146 - (52%)
Similarity:105/146 - (71%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPP 272
            :.:.|:::|:.:...|....|.|..|||:||||.|||.|||::.|:||.|.:.|.||.:|||.||
Zfish     1 MALKRIQKELQDLQRDPPAQCSAGPVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPP 65

  Fly   273 YLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGN 337
            .:||.||.||.||..:|.||||||.|:|||||:|||||:||.|||.||||.||:...:|.::|.:
Zfish    66 KVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSD 130

  Fly   338 RALHDKNAREWTKKYA 353
            :..:::.|||||:|||
Zfish   131 KEKYNRLAREWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 77/146 (53%)
UQ_con 212..349 CDD:278603 72/136 (53%)
ube2d1bNP_955958.1 UBCc 1..146 CDD:412187 75/144 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.