DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and CG2574

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:157 Identity:71/157 - (45%)
Similarity:103/157 - (65%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SGIPTQGDPLT--ITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEI 261
            ||..|:. |||  :.|::.|:.:...:....|.|::...:|.||.|.:.||..:|||||.||::|
  Fly    52 SGKSTEA-PLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDI 115

  Fly   262 VFPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPM 326
            .||.:|||..|.:.|.|:.||||:...|.||||:||.:|||.::|:|||:||..|:::.||.||:
  Fly   116 RFPASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPL 180

  Fly   327 EVSVADVFKGNRALHDKNAREWTKKYA 353
            .:.:||.:|.||..|||.||.|||.:|
  Fly   181 VMCIADQYKTNRREHDKIARHWTKLFA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 68/149 (46%)
UQ_con 212..349 CDD:278603 61/136 (45%)
CG2574NP_572796.1 COG5078 66..208 CDD:227410 65/142 (46%)
UQ_con 66..203 CDD:278603 61/136 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124127at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.