DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2o

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_221132.5 Gene:Ube2o / 303689 RGDID:1310297 Length:1291 Species:Rattus norvegicus


Alignment Length:271 Identity:63/271 - (23%)
Similarity:103/271 - (38%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TMDERQRARIEAMAAIAAGTDSEDTEGSAEEVRSQSFFAVSVFLTARLGTPGRRATSTPAAVPSR 132
            |:|....|..|.|.|:      .|||...::...||                             
  Rat   867 TLDNVAIAEEEKMEAV------PDTERKEDKPEVQS----------------------------- 896

  Fly   133 RGRRTVSISVATPSNPPVRATVIRQGSQMHLTRGLPTVTENVPMDETFDT-ESLQSNSLVLRL-F 195
                  .:....||..||   :.:|      ..|.|.||......|.|.. |...||....:: |
  Rat   897 ------PVKAEWPSETPV---LCQQ------CGGRPGVTFTSAKGEVFSVLEFAPSNHSFKKIEF 946

  Fly   196 RIESGIPTQGDPLTITRLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVE 260
            :     |.:......| :|:|::..:|...:|...:...|.:..:.|.|.||:.|.||.|.:..:
  Rat   947 Q-----PPEAKKFFST-VRKEMALLATSLPDGIMVKTFEDRMDLFSALIKGPTRTPYEDGLYLFD 1005

  Fly   261 IVFPRNYPFYPPYLAFLTKTYHC------NIALSGRICLDILGS-------KWSPALSVSKVLIS 312
            |..|..||..||:..:|::   |      |:..:|::|:.:||:       :|:...|:.:||||
  Rat  1006 IQLPNIYPAVPPHFCYLSQ---CSGRLNPNLYDNGKVCVSLLGTWIGKGTERWTSKSSLLQVLIS 1067

  Fly   313 IMSLLADPNPH 323
            |..|:....|:
  Rat  1068 IQGLILVNEPY 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 36/130 (28%)
UQ_con 212..349 CDD:278603 35/125 (28%)
Ube2oXP_221132.5 UBCc 958..1108 CDD:238117 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.