DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2a

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001013955.1 Gene:Ube2a / 298317 RGDID:1359534 Length:162 Species:Rattus norvegicus


Alignment Length:150 Identity:53/150 - (35%)
Similarity:73/150 - (48%) Gaps:17/150 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEG----------GRFRVEIVFPRN 266
            ||.|:......|...|.......:|:..|.|.|.||..|.:|.          |.|::.|.|...
  Rat     8 RLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTHVETTGQLGTFKLTIEFTEE 72

  Fly   267 YPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVA 331
            ||..||.:.|::|.:|.|:...|.||||||.::|||...||.:|.||.|||.:|||:.|.....|
  Rat    73 YPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAA 137

  Fly   332 DVFKGNRALHDKNAREWTKK 351
            .       |:.:|.||:.|:
  Rat   138 Q-------LYQENKREYEKR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 53/149 (36%)
UQ_con 212..349 CDD:278603 52/146 (36%)
Ube2aNP_001013955.1 UQ_con 8..155 CDD:395127 53/149 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.