DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2e3

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001041322.2 Gene:Ube2e3 / 295686 RGDID:1308894 Length:207 Species:Rattus norvegicus


Alignment Length:142 Identity:74/142 - (52%)
Similarity:98/142 - (69%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAF 276
            |:::|::|.:.|....|.|...|||::.|.:||.||..:|||||.|.::|.|..:|||.||.:.|
  Rat    65 RIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTF 129

  Fly   277 LTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALH 341
            .|:.|||||...|.||||||...|||||::||||:||.|||.|.||.||:..|:|..:..|||.|
  Rat   130 RTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEH 194

  Fly   342 DKNAREWTKKYA 353
            |:.||:|||:||
  Rat   195 DRIARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 74/142 (52%)
UQ_con 212..349 CDD:278603 69/136 (51%)
Ube2e3NP_001041322.2 UQ_con 65..202 CDD:395127 69/136 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.