DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2k

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_038947644.1 Gene:Ube2k / 289623 RGDID:1311626 Length:210 Species:Rattus norvegicus


Alignment Length:164 Identity:61/164 - (37%)
Similarity:90/164 - (54%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LTITRLRREI-----------------SEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGG 255
            |.:.||||..                 :|.|.:|   .|.::|.:|.......|.||.:|.||||
  Rat     3 LPLERLRRPPGSAWCACADPAPFWWPGAETSKNQ---IKVDLVDENFTELRGEIAGPPDTPYEGG 64

  Fly   256 RFRVEIVFPRNYPFYPPYLAFLTKTYHCNI-ALSGRICLDILGSKWSPALSVSKVLISIMSLLAD 319
            |:::||..|..|||.||.:.|:||.:|.|| :::|.||||||..:|:.|:::..||:|:.:|||.
  Rat    65 RYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAA 129

  Fly   320 PNPHDPMEVSVADVFKGNRALHDKNAREWTKKYA 353
            ..|.||.:..||:.:|.|..:..:.||.|...||
  Rat   130 AEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 61/164 (37%)
UQ_con 212..349 CDD:278603 57/154 (37%)
Ube2kXP_038947644.1 UBCc 35..159 CDD:238117 51/126 (40%)
UBA_II_E2_UBE2K 173..210 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.