DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and Ube2e2

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_017171445.1 Gene:Ube2e2 / 218793 MGIID:2384997 Length:239 Species:Mus musculus


Alignment Length:156 Identity:74/156 - (47%)
Similarity:99/156 - (63%) Gaps:14/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RLRREISEFSTDQTEGCK--------------AEMVGDNLFHWVATIPGPSETVYEGGRFRVEIV 262
            |:::|::|.:.|....|:              |...|||::.|.:||.||..:|||||.|.::|.
Mouse    83 RIQKELAEITLDPPPNCRHMFYDSKWVPEALSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIT 147

  Fly   263 FPRNYPFYPPYLAFLTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPME 327
            |..:|||.||.:.|.|:.|||||...|.||||||...|||||::||||:||.|||.|.||.||:.
Mouse   148 FSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV 212

  Fly   328 VSVADVFKGNRALHDKNAREWTKKYA 353
            .|:|..:..|||.||:.||:|||:||
Mouse   213 GSIATQYMTNRAEHDRMARQWTKRYA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 74/156 (47%)
UQ_con 212..349 CDD:278603 69/150 (46%)
Ube2e2XP_017171445.1 UQ_con 83..234 CDD:365926 69/150 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.