DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and ubc-24

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_495769.2 Gene:ubc-24 / 186057 WormBaseID:WBGene00006719 Length:160 Species:Caenorhabditis elegans


Alignment Length:163 Identity:39/163 - (23%)
Similarity:76/163 - (46%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GDPLTITRLRREISEFSTD---------QTEGCK----AEMVGDNLFHWVATIPGPSETVYEGGR 256
            |..:.::|:|:||::.:.:         :.|.||    .:::||.:             :|:...
 Worm    10 GRIVQLSRIRKEIADLAKNKRRFIKDFRKIEKCKDIFQFKIIGDGV-------------LYKNMI 61

  Fly   257 FRVEIVFPRNYPFYPPYLAFLTKTYHCNI-ALSGRICLD-ILGSKWSPALSVSKVLISIMSLLAD 319
            |.:.:.....|||.||||.|....||.|: .::..:|.. :|...|.|..::..||::::.||.:
 Worm    62 FTLTLDVNVEYPFKPPYLKFCHNVYHPNVDPVTCELCSPMLLQENWKPETTMEDVLLNLIVLLNE 126

  Fly   320 PNPHDPMEVSVADVFKGNRALHDKNAREWTKKY 352
            |:...|:.:..|..:..|:....|.:.|..||:
 Worm   127 PDLSRPVNIDAAHDYIHNKVEFVKKSTELAKKW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 38/161 (24%)
UQ_con 212..349 CDD:278603 36/151 (24%)
ubc-24NP_495769.2 UBCc 17..160 CDD:214562 38/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.