DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10862 and ube2c

DIOPT Version :9

Sequence 1:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001095283.1 Gene:ube2c / 100124324 XenbaseID:XB-GENE-971108 Length:179 Species:Xenopus tropicalis


Alignment Length:143 Identity:51/143 - (35%)
Similarity:79/143 - (55%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAF 276
            ||::|:........:|..|....||||.|:.||.|...||||..|:::.:.||..||:..|.:.|
 Frog    34 RLQQELMTLMMSGDKGISAFPESDNLFKWIGTIDGAVGTVYESLRYKLSLEFPSGYPYNAPTVKF 98

  Fly   277 LTKTYHCNIALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALH 341
            :|..:|.|:...|.||||||..|||....|..:|:|:.|||.:||...|:....|:::: |:..:
 Frog    99 VTPCFHPNVDSHGNICLDILKDKWSALYDVRTILLSLQSLLGEPNNESPLNPYAAELWQ-NQTAY 162

  Fly   342 DKNAREWTKKYAK 354
            .|:..|..:|..:
 Frog   163 KKHLHEQYQKQVR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10862NP_647823.1 COG5078 207..354 CDD:227410 51/141 (36%)
UQ_con 212..349 CDD:278603 50/136 (37%)
ube2cNP_001095283.1 UQ_con 34..170 CDD:365926 50/136 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.