DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and KLF7

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_005246983.1 Gene:KLF7 / 8609 HGNCID:6350 Length:303 Species:Homo sapiens


Alignment Length:270 Identity:104/270 - (38%)
Similarity:128/270 - (47%) Gaps:78/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 LQQLCPPAAPSTPSTSSSSISSSSASSASRHMFVPPLTPPSSDPGSPGSSMVAAAAAAAAQRRTT 549
            |.:.|....|     :|||:.|.:|.:.::...|..||||||                       
Human   105 LSETCLSLQP-----ASSSLDSYTAVNQAQLNAVTSLTPPSS----------------------- 141

  Fly   550 PPPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTTL------TPASAIQQQQQQPQQQQV 608
               |....|   |:....||..:.|..|....:....|:::      |.|:|:            
Human   142 ---PELSRH---LVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAV------------ 188

  Fly   609 PQQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSK 673
                     .::|..:.|:....|.|..|...               || .|:|:|.|.|.||.|
Human   189 ---------TAAGAVKSGQSDSDQGGLGAEAC---------------PE-NKKRVHRCQFNGCRK 228

  Fly   674 VYTKSSHLKAHQRIHTG-EKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSD 737
            |||||||||||||.||| ||||.|.|..||||||||||||||||||||||||||..|:|.|:|||
Human   229 VYTKSSHLKAHQRTHTGSEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSD 293

  Fly   738 HLALHMKRHL 747
            |||||||||:
Human   294 HLALHMKRHI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 54/83 (65%)
C2H2 Zn finger 671..688 CDD:275368 15/16 (94%)
zf-H2C2_2 680..707 CDD:290200 21/27 (78%)
C2H2 Zn finger 696..718 CDD:275368 18/21 (86%)
zf-H2C2_2 710..735 CDD:290200 20/24 (83%)
C2H2 Zn finger 726..746 CDD:275368 14/19 (74%)
KLF7XP_005246983.1 KLF7_N 2..220 CDD:409244 35/185 (19%)
COG5048 <224..>282 CDD:227381 49/57 (86%)
C2H2 Zn finger 224..243 CDD:275368 16/18 (89%)
C2H2 Zn finger 252..274 CDD:275368 18/21 (86%)
zf-H2C2_2 266..291 CDD:404364 20/24 (83%)
zf-C2H2 280..302 CDD:395048 16/21 (76%)
C2H2 Zn finger 282..302 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D416605at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.