DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and COM2

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_011056.1 Gene:COM2 / 856867 SGDID:S000000932 Length:443 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:57/252 - (22%)
Similarity:86/252 - (34%) Gaps:84/252 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 SSSSISSSSASSASRHMFVPPLTPPSSDPGSPGSSMVAAAAAAAAQRRTTPPPPYQQGHVMGLIN 564
            |...:||:..|..|.|..:.||            .:|......:.|.......|::.|....:|.
Yeast   268 SGFDVSSNEESDESDHAIINPL------------KLVGNNKDISTQSIAKTTNPFKSGSDFKMIE 320

  Fly   565 PPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQQPQQQQVPQQQPPPTPRSSGGGRRGRHS 629
            |         .:..||:|....|      :||.:....|.     ...|.|:.:||..      |
Yeast   321 P---------VSKFSNDSRKDLL------AAISEPSSSPS-----PSAPSPSVQSSSS------S 359

  Fly   630 HHQPGTAAHIASLMSVR----TVRYNRRNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTG 690
            |.           :.||    :::..|...|.|                            |...
Yeast   360 HG-----------LVVRKKTGSMQKTRGRKPSL----------------------------IPDA 385

  Fly   691 EKPYTCQWPECEWRFARSDELTRHYRK-HTGAKPFKCIVCERSFARSDHLALHMKRH 746
            .|.:.|::  |:.||.|.:.|.||.|. |...|||.|.:|.::|:|||:|..|:|.|
Yeast   386 SKQFGCEF--CDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTH 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 18/87 (21%)
C2H2 Zn finger 671..688 CDD:275368 0/16 (0%)
zf-H2C2_2 680..707 CDD:290200 6/26 (23%)
C2H2 Zn finger 696..718 CDD:275368 9/22 (41%)
zf-H2C2_2 710..735 CDD:290200 11/25 (44%)
C2H2 Zn finger 726..746 CDD:275368 9/19 (47%)
COM2NP_011056.1 COG5048 1..443 CDD:227381 57/252 (23%)
C2H2 Zn finger 391..412 CDD:275368 9/22 (41%)
C2H2 Zn finger 420..440 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.