DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and FZF1

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_011260.1 Gene:FZF1 / 852638 SGDID:S000003223 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:36/92 - (39%)
Similarity:48/92 - (52%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 KRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPF 724
            |.|.:.|.|.||.|||.:.|.|:.||..||.:|||.|..|.|..:|.|...|..|...|:..||.
Yeast     8 KSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPK 72

  Fly   725 KCIVCERSFARSDHLALHMKRHLPKNK 751
            .|.:|::.|..:..|..|:..|..|:|
Yeast    73 ACTLCQKRFVTNQQLRRHLNSHERKSK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 27/63 (43%)
C2H2 Zn finger 671..688 CDD:275368 8/16 (50%)
zf-H2C2_2 680..707 CDD:290200 12/26 (46%)
C2H2 Zn finger 696..718 CDD:275368 7/21 (33%)
zf-H2C2_2 710..735 CDD:290200 8/24 (33%)
C2H2 Zn finger 726..746 CDD:275368 5/19 (26%)
FZF1NP_011260.1 COG5048 15..297 CDD:227381 33/85 (39%)
C2H2 Zn finger 17..36 CDD:275368 9/18 (50%)
C2H2 Zn finger 44..66 CDD:275368 7/21 (33%)
C2H2 Zn finger 74..94 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1623
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.