Sequence 1: | NP_001097493.1 | Gene: | dar1 / 38436 | FlyBaseID: | FBgn0263239 | Length: | 751 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_077744.4 | Gene: | WT1 / 7490 | HGNCID: | 12796 | Length: | 522 | Species: | Homo sapiens |
Alignment Length: | 443 | Identity: | 108/443 - (24%) |
---|---|---|---|
Similarity: | 148/443 - (33%) | Gaps: | 158/443 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 454 SAAASATASATATPTAQLGAQQQQQQQQQQQLQQLCPPAAPSTPSTSSSSISSSSASSASRHMFV 518
Fly 519 PPLTPPSSDPGSPGSSMVAAAAAAAAQRRTTPPPP-----------------------------Y 554
Fly 555 QQGHVMGL--------INPPPTLQLLGGAATGSNN-----SCTTT--------LTTLT------- 591
Fly 592 -----------PASAIQQQQQQPQQQQVPQQQ---PPP--------------------TPRSS-- 620
Fly 621 ------------------GGGRRG-------------RHSHHQPGTAA--HIASLMSVRTVRYNR 652
Fly 653 ---------------------RNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTC 696
Fly 697 QWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRHLPK 749 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dar1 | NP_001097493.1 | COG5048 | 641..>724 | CDD:227381 | 38/103 (37%) |
C2H2 Zn finger | 671..688 | CDD:275368 | 9/16 (56%) | ||
zf-H2C2_2 | 680..707 | CDD:290200 | 16/26 (62%) | ||
C2H2 Zn finger | 696..718 | CDD:275368 | 12/21 (57%) | ||
zf-H2C2_2 | 710..735 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 726..746 | CDD:275368 | 10/19 (53%) | ||
WT1 | NP_077744.4 | WT1 | 74..394 | CDD:308009 | 52/330 (16%) |
COG5048 | 386..>514 | CDD:227381 | 50/96 (52%) | ||
C2H2 Zn finger | 401..420 | CDD:275368 | 10/18 (56%) | ||
C2H2 Zn finger | 428..450 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 458..478 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 489..511 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23235 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |