DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and Klf16

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001121076.1 Gene:Klf16 / 690820 RGDID:1305966 Length:251 Species:Rattus norvegicus


Alignment Length:224 Identity:79/224 - (35%)
Similarity:95/224 - (42%) Gaps:50/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 PGSPGSSMVAAAAAAAAQRRTTPP-----PPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTL 587
            ||..|:...|.....|.:|..|||     ||           ||.|....|||         |..
  Rat    30 PGPEGAGPAAGLDVRATRREATPPGTPGAPP-----------PPATAPGSGGA---------TAA 74

  Fly   588 TTLTPASAIQQQQQQPQQQQVPQQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNR 652
            ..|..||.:...:..|............:|.||........|...||.|                
  Rat    75 PHLLAASILADLRGGPGVATAANTAGGTSPVSSSSAASSPSSGRAPGAA---------------- 123

  Fly   653 RNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRK 717
                     :.|.|.|.||:|.|.||||||:|.|.||||:|:.|.||.|:.:|||||||.||:|.
  Rat   124 ---------KSHRCPFPGCAKAYYKSSHLKSHLRTHTGERPFACDWPGCDKKFARSDELARHHRT 179

  Fly   718 HTGAKPFKCIVCERSFARSDHLALHMKRH 746
            |||.|.|.|.:|.:.|.|||||..|.:||
  Rat   180 HTGEKRFPCPLCTKRFTRSDHLTKHARRH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 38/82 (46%)
C2H2 Zn finger 671..688 CDD:275368 11/16 (69%)
zf-H2C2_2 680..707 CDD:290200 15/26 (58%)
C2H2 Zn finger 696..718 CDD:275368 14/21 (67%)
zf-H2C2_2 710..735 CDD:290200 13/24 (54%)
C2H2 Zn finger 726..746 CDD:275368 9/19 (47%)
Klf16NP_001121076.1 KLF16_N 2..127 CDD:409237 29/141 (21%)
COG5048 124..>186 CDD:227381 38/61 (62%)
C2H2 Zn finger 131..150 CDD:275368 12/18 (67%)
C2H2 Zn finger 158..180 CDD:275368 14/21 (67%)
zf-C2H2 186..208 CDD:395048 10/21 (48%)
C2H2 Zn finger 188..208 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.