DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dar1 and klf9

DIOPT Version :9

Sequence 1:	NP_001097493.1	Gene:	dar1 / 38436	FlyBaseID:	FBgn0263239	Length:	751	Species:	Drosophila melanogaster
Sequence 2:	NP_001122201.1	Gene:	klf9 / 565869	ZFINID:	ZDB-GENE-060526-244	Length:	216	Species:	Danio rerio

Alignment Length:	102	Identity:	56/102 - (54%)
Similarity:	70/102 - (68%)	Gaps:	2/102 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   645 VRTVRYNRRNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSD 709
            |:..|...|.:...|||  |.|.:.||.|:|.||||||||.|:||||:|:.|.||.|..:|:|||
Zfish    82 VKRTRKRDRLHASAEKR--HCCPYAGCGKIYGKSSHLKAHFRVHTGERPFQCTWPGCAKKFSRSD 144

  Fly   710 ELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRH 746
            |||||:|.|||.|.|.|.:|::.|.|||||..|.:||
Zfish   145 ELTRHFRTHTGEKRFMCPLCDKCFMRSDHLTKHARRH 181

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dar1	NP_001097493.1	COG5048	641..>724	CDD:227381	44/78 (56%)
		C2H2 Zn finger	671..688	CDD:275368	12/16 (75%)
		zf-H2C2_2	680..707	CDD:290200	16/26 (62%)
		C2H2 Zn finger	696..718	CDD:275368	14/21 (67%)
		zf-H2C2_2	710..735	CDD:290200	14/24 (58%)
		C2H2 Zn finger	726..746	CDD:275368	9/19 (47%)
klf9	NP_001122201.1	C2H2 Zn finger	101..123	CDD:275368	14/21 (67%)
		COG5048	113..>161	CDD:227381	32/47 (68%)
		C2H2 Zn finger	131..153	CDD:275368	14/21 (67%)
		zf-H2C2_2	145..168	CDD:290200	13/22 (59%)
		zf-C2H2	159..181	CDD:278523	10/21 (48%)
		C2H2 Zn finger	161..181	CDD:275368	9/19 (47%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910