DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and klf7a

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001018479.1 Gene:klf7a / 553670 ZFINID:ZDB-GENE-050522-276 Length:286 Species:Danio rerio


Alignment Length:221 Identity:97/221 - (43%)
Similarity:113/221 - (51%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 PPPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQQPQQQQVPQQQPP 614
            ||.|.|:......|:|..||        |.|.:....:|:|||.|:.:..:...:........|.
Zfish    86 PPSPPQRKETRSSISPDATL--------GVNAAQLNAVTSLTPPSSPELGRHLVKPTHTLSASPD 142

  Fly   615 -----------------------PTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNP 656
                                   |.|.|...|..|..|..:.|....|    .|..:..|     
Zfish   143 GTLTLKLVARKVGLSSAKLVAAHPVPLSPQHGSTGTQSDGEQGGTCTI----GVGDMAEN----- 198

  Fly   657 ELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGA 721
               |:|:|.|.|.||.||||||||||||||.|||||||.|.|..|||||||||||||||||||||
Zfish   199 ---KKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGA 260

  Fly   722 KPFKCIVCERSFARSDHLALHMKRHL 747
            |||||..|:|.|:||||||||||||:
Zfish   261 KPFKCNHCDRCFSRSDHLALHMKRHV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 54/82 (66%)
C2H2 Zn finger 671..688 CDD:275368 15/16 (94%)
zf-H2C2_2 680..707 CDD:290200 21/26 (81%)
C2H2 Zn finger 696..718 CDD:275368 18/21 (86%)
zf-H2C2_2 710..735 CDD:290200 20/24 (83%)
C2H2 Zn finger 726..746 CDD:275368 14/19 (74%)
klf7aNP_001018479.1 COG5048 197..>268 CDD:227381 57/78 (73%)
C2H2 Zn finger 208..227 CDD:275368 16/18 (89%)
zf-H2C2_2 219..>235 CDD:290200 14/15 (93%)
C2H2 Zn finger 235..257 CDD:275368 18/21 (86%)
zf-H2C2_2 249..274 CDD:290200 20/24 (83%)
C2H2 Zn finger 265..285 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D416605at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.