DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and klf7b

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001038231.1 Gene:klf7b / 553082 ZFINID:ZDB-GENE-041014-171 Length:295 Species:Danio rerio


Alignment Length:264 Identity:106/264 - (40%)
Similarity:125/264 - (47%) Gaps:82/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 PLTPPSSDPGSPGSSMVAAAAAAAAQRRTTPPPPYQQGHVMGLINPPPTLQL----------LGG 574
            ||.|..||..|                    |||.       |::.|.||..          |..
Zfish    78 PLLPSLSDEPS--------------------PPPL-------LVSLPKTLHTPANTKSTDAGLKE 115

  Fly   575 AATGSNNSCTTTLTTLTPASA--IQQQQQQPQQ------------------------QQVPQQQP 613
            |:.|.|.:....:|:|||.|:  :.:...:|.|                        :.|.....
Zfish   116 ASGGVNPAQLNAVTSLTPPSSPELGRHLVKPTQTLTATADGTLTLKLVAKKVGLGAAKLVATHSI 180

  Fly   614 PPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSKVYTKS 678
            |..|      .||..|..:.|          :.||  ...:.|| .|:|:|.|.|.||.||||||
Zfish   181 PSPP------NRGTQSDGEGG----------LGTV--GGGDIPE-NKKRVHRCQFNGCRKVYTKS 226

  Fly   679 SHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHLALHM 743
            ||||||||.|||||||.|.|..||||||||||||||||||||||||||..|:|.|:|||||||||
Zfish   227 SHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHM 291

  Fly   744 KRHL 747
            |||:
Zfish   292 KRHI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 56/82 (68%)
C2H2 Zn finger 671..688 CDD:275368 15/16 (94%)
zf-H2C2_2 680..707 CDD:290200 21/26 (81%)
C2H2 Zn finger 696..718 CDD:275368 18/21 (86%)
zf-H2C2_2 710..735 CDD:290200 20/24 (83%)
C2H2 Zn finger 726..746 CDD:275368 14/19 (74%)
klf7bNP_001038231.1 COG5048 205..>277 CDD:227381 58/72 (81%)
C2H2 Zn finger 214..236 CDD:275368 18/21 (86%)
zf-H2C2_2 228..>244 CDD:290200 14/15 (93%)
C2H2 Zn finger 244..266 CDD:275368 18/21 (86%)
zf-H2C2_2 258..283 CDD:290200 20/24 (83%)
C2H2 Zn finger 274..294 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D416605at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.