DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and hkb

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster


Alignment Length:342 Identity:87/342 - (25%)
Similarity:128/342 - (37%) Gaps:111/342 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 SQLVSGSGGGYLNG---SSSNSYGYSWHSSQSFHTKYQIHPPSAAASATASATATPTAQLGAQQQ 476
            ::|.|.|.|...:|   |:|:|...|.:||:|.:.:...|         :|.|.|.|..|.|   
  Fly    45 TELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNH---------SSYTRTSTPLLDA--- 97

  Fly   477 QQQQQQQQLQQLCPPAAPSTPSTSSSSISSSSASSASRHMFVPPLTPPSSDPG--SPGSSMVAAA 539
                        .|....|.|  .||.:.:.:|::||       |.||:....  |..|.:..||
  Fly    98 ------------APHPVFSHP--QSSPLDTHAAATAS-------LAPPNQHAPFLSAASDLYYAA 141

  Fly   540 AAAAAQRRTTPPPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQQPQ 604
            |||||...:||..      |.|....|.|:.|:       .......:.......|:..::|:|:
  Fly   142 AAAAAAAASTPTA------VPGFGMDPFTMGLM-------EQEYARVMAEDAQLKALNSRKQRPK 193

  Fly   605 QQQVPQQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFV 669
            :.:.|                                                            
  Fly   194 KFKCP------------------------------------------------------------ 198

  Fly   670 GCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFA 734
            .|...::.:..||.|.||||||:|:.|....|...|.|::|||||.|.|||.:|:.|..|.:.|.
  Fly   199 NCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFG 263

  Fly   735 RSDHLALHMKRHLPKNK 751
            |.|||..|||.|:|:.:
  Fly   264 RRDHLKKHMKTHMPQER 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 24/82 (29%)
C2H2 Zn finger 671..688 CDD:275368 5/16 (31%)
zf-H2C2_2 680..707 CDD:290200 13/26 (50%)
C2H2 Zn finger 696..718 CDD:275368 10/21 (48%)
zf-H2C2_2 710..735 CDD:290200 13/24 (54%)
C2H2 Zn finger 726..746 CDD:275368 10/19 (53%)
hkbNP_524221.1 COG5048 195..>261 CDD:227381 28/125 (22%)
zf-C2H2 195..217 CDD:278523 6/81 (7%)
C2H2 Zn finger 197..217 CDD:275368 6/79 (8%)
zf-H2C2_2 210..236 CDD:290200 13/25 (52%)
C2H2 Zn finger 225..247 CDD:275368 10/21 (48%)
zf-H2C2_2 239..264 CDD:290200 13/24 (54%)
C2H2 Zn finger 255..275 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.