DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and zf30C

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster


Alignment Length:94 Identity:30/94 - (31%)
Similarity:39/94 - (41%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 HHCDFVGCSKVYTKSSHLKAHQRI-HTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCI 727
            :.||  .|.|.:...:..|:|.:. ||..|||.|..  |...:...:.|..|...|||.|.|.|.
  Fly   601 YQCD--KCGKTFKVKAQYKSHLKTRHTDYKPYKCHL--CPKEYPYRESLLTHMTVHTGIKRFLCN 661

  Fly   728 VCERSFARSDHLALHMKRH------LPKN 750
            .|.:.|....:|..|.|.|      ||.|
  Fly   662 NCGKRFTCISNLQAHRKVHADTCGQLPLN 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 19/60 (32%)
C2H2 Zn finger 671..688 CDD:275368 4/17 (24%)
zf-H2C2_2 680..707 CDD:290200 9/27 (33%)
C2H2 Zn finger 696..718 CDD:275368 4/21 (19%)
zf-H2C2_2 710..735 CDD:290200 10/24 (42%)
C2H2 Zn finger 726..746 CDD:275368 6/19 (32%)
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370
COG5048 <523..>672 CDD:227381 23/74 (31%)
C2H2 Zn finger 546..566 CDD:275368
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 603..624 CDD:275368 6/22 (27%)
C2H2 Zn finger 632..652 CDD:275368 4/21 (19%)
C2H2 Zn finger 660..680 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRQ6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.