DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and odd

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster


Alignment Length:529 Identity:113/529 - (21%)
Similarity:154/529 - (29%) Gaps:260/529 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 MLSSSGSSNNNGSSNSSSNTG---ESATSQLPQVKMEAIDESLLETFSTPLLSPLEIKTEKQQRQ 310
            |.|:|.|..:|.:.:...|..   :.|......:|.|.      ||..:|:|:|....||:..|:
  Fly     1 MSSTSASPISNITVDDELNLSREQDFAEEDFIVIKEER------ETSLSPMLTPPHTPTEEPLRR 59

  Fly   311 ------------QQHQ----HQQQQQQQQQQQQQHQQQHQQQYQQQHYQQHYQQQHLYQHHPSLA 359
                        |.|.    |.|||||||||||||:                             
  Fly    60 VHPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQHR----------------------------- 95

  Fly   360 LPGLPPAVDVVELQLQQQHQQQQHLQHNNSSSSSPKLATPGDNSGNTSSYQQQYASQLVSGSGGG 424
                        |.||.|.|||||        .:|:                             
  Fly    96 ------------LWLQMQQQQQQH--------QAPQ----------------------------- 111

  Fly   425 YLNGSSSNSYGYSWHSSQSFHTKYQIHPPSAAASATASATATPTA---QL-------GAQQQQQQ 479
                                  :|.::|         :|:|.|.|   ||       .|..||||
  Fly   112 ----------------------QYPVYP---------TASADPVAVHQQLMNHWIRNAAIYQQQQ 145

  Fly   480 QQQQQLQQLCPPAAPSTPSTSSSSISSSSASSASRHMFVPPLTPPSSDPGSPGSSMVAAAAAAAA 544
            ||||..........|..|......:....|...|.|..|                          
  Fly   146 QQQQHPHHHHHHGHPHHPHPHPHHVRPYPAGLHSLHAAV-------------------------- 184

  Fly   545 QRRTTPPPPYQQGHVMGLINPPPTLQLLG-GAATGSNNSCTTTLTTLTPASAIQQQQQQPQQQQV 608
                       .|...|.:   |||:|.| |.|:|..:..|.:              .:|::|.:
  Fly   185 -----------MGRHFGAM---PTLKLGGAGGASGVPSGATGS--------------SRPKKQFI 221

  Fly   609 PQQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSK 673
                                                                     |.:  |::
  Fly   222 ---------------------------------------------------------CKY--CNR 227

  Fly   674 VYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDH 738
            .:|||.:|..|:|.||.|:||:|.  .|...|.|.|.|..|...|:..|||||..|.:.|.:|..
  Fly   228 QFTKSYNLLIHERTHTDERPYSCD--ICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRT 290

  Fly   739 LALHMKRHL 747
            ||:|...||
  Fly   291 LAVHKVTHL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 22/82 (27%)
C2H2 Zn finger 671..688 CDD:275368 7/16 (44%)
zf-H2C2_2 680..707 CDD:290200 11/26 (42%)
C2H2 Zn finger 696..718 CDD:275368 7/21 (33%)
zf-H2C2_2 710..735 CDD:290200 10/24 (42%)
C2H2 Zn finger 726..746 CDD:275368 7/19 (37%)
oddNP_722922.1 COG5048 <203..334 CDD:227381 39/172 (23%)
C2H2 Zn finger 222..242 CDD:275368 8/21 (38%)
zf-H2C2_2 234..259 CDD:290200 11/26 (42%)
C2H2 Zn finger 250..270 CDD:275368 7/21 (33%)
zf-H2C2_2 262..285 CDD:290200 9/22 (41%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-C2H2 304..326 CDD:278523
C2H2 Zn finger 306..326 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1951
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.