DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and klf6a

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_958869.2 Gene:klf6a / 280650 ZFINID:ZDB-GENE-021115-9 Length:283 Species:Danio rerio


Alignment Length:284 Identity:104/284 - (36%)
Similarity:131/284 - (46%) Gaps:86/284 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 GAQQQQQQQQQQQLQQLCPPAAPSTPSTSSSSISSSSASSASRHMFVPPLTPPSSDPGSPGSSMV 536
            |:....::...|..|.|   ...|..|.:||..|.||...:..|:|       :|:|        
Zfish    78 GSLPSVKEDDNQDCQIL---ETNSMNSDASSEASDSSEELSPTHIF-------TSNP-------- 124

  Fly   537 AAAAAAAAQRRTTPPPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQ 601
                                               ||...|.|.:..::::.:..|:|     .:
Zfish   125 -----------------------------------LGSVLTESAHHLSSSIISTPPSS-----PE 149

  Fly   602 QPQQQQVPQ--------QQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPEL 658
            .||:..|||        ...|...|.:|.|:                :|....|   ....:|: 
Zfish   150 MPQEPGVPQVWGSTQTDLHIPVKIRQNGLGK----------------ALDKTTT---GGDASPD- 194

  Fly   659 EKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKP 723
            .:||:|.|.|.||.||||||||||||||.|||||||.|.|..||||||||||||||:||||||||
Zfish   195 GRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKP 259

  Fly   724 FKCIVCERSFARSDHLALHMKRHL 747
            |||..|:|.|:|||||||||||||
Zfish   260 FKCSHCDRCFSRSDHLALHMKRHL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 54/82 (66%)
C2H2 Zn finger 671..688 CDD:275368 15/16 (94%)
zf-H2C2_2 680..707 CDD:290200 21/26 (81%)
C2H2 Zn finger 696..718 CDD:275368 17/21 (81%)
zf-H2C2_2 710..735 CDD:290200 19/24 (79%)
C2H2 Zn finger 726..746 CDD:275368 14/19 (74%)
klf6aNP_958869.2 COG5048 171..>265 CDD:227381 61/113 (54%)
C2H2 Zn finger 205..224 CDD:275368 16/18 (89%)
C2H2 Zn finger 232..254 CDD:275368 17/21 (81%)
zf-H2C2_2 246..271 CDD:290200 19/24 (79%)
C2H2 Zn finger 262..282 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D416605at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.