DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and klf-3

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:289 Identity:97/289 - (33%)
Similarity:132/289 - (45%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 PTAQLGAQQQQQQQQQQQLQQLCPPAAPSTPSTSSSSISSSSASSASRHMFVPPL-------TPP 524
            ||....|.........||:....||.||.:..|..             .::.||.       .|.
 Worm    74 PTPHFQAPFSPHPPPVQQVPSYSPPHAPPSYETYP-------------EVYYPPHIICNPYDVPT 125

  Fly   525 SSDPGSPGSSMVAAAAAAAAQRRTTPPPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTT 589
            :||...|..:.|...:|......|  ||.::       |..||:                     
 Worm   126 TSDRNPPYYTEVTTVSAVTLHSMT--PPTHK-------IETPPS--------------------- 160

  Fly   590 LTPASAIQQQQQQPQQQQVP--QQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNR 652
             :|.::.     .|...|:|  :.:.|..|....|......|.....|::..:.|.....:..|:
 Worm   161 -SPENSF-----GPLASQLPAIKMEIPMHPLPHNGELDSTRSSPSSTTSSERSPLQRKSRIESNK 219

  Fly   653 RNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRK 717
            | ||..:|..:|.|.:.||.|.|:||||||||:|.|:||||:.|:|..|.|:||||||||||.||
 Worm   220 R-NPTDKKFVVHACTYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRK 283

  Fly   718 HTGAKPFKCIVCERSFARSDHLALHMKRH 746
            |||.|||:|.:|:|:|||||||:||||||
 Worm   284 HTGDKPFRCSLCDRNFARSDHLSLHMKRH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 46/82 (56%)
C2H2 Zn finger 671..688 CDD:275368 12/16 (75%)
zf-H2C2_2 680..707 CDD:290200 16/26 (62%)
C2H2 Zn finger 696..718 CDD:275368 15/21 (71%)
zf-H2C2_2 710..735 CDD:290200 17/24 (71%)
C2H2 Zn finger 726..746 CDD:275368 14/19 (74%)
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 13/18 (72%)
C2H2 Zn finger 262..284 CDD:275368 15/21 (71%)
zf-H2C2_2 276..301 CDD:290200 17/24 (71%)
C2H2 Zn finger 292..312 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.